Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.

Search Within Results

5,086 – 5,100 of 1,799,085 results

5,086

Invitrogen™ Aquaporin 4 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Western Blot
Form	Liquid
Gene Accession No.	P55087, P55088
Isotype	IgG
Concentration	0.30 mg/mL
Antigen	Aquaporin 4
Gene Symbols	AQP4
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	Aqp4; AQP-4; aquaporin 4; aquaporin type4; Aquaporin4; aquaporin-4; HMIWC2; Mercurial-insensitive water channel; MGC22454; MIWC; MIWC2; WCH4
Gene	AQP4
Product Type	Antibody
Gene ID (Entrez)	11829, 361
Formulation	PBS with 40% glycerol and 0.02% sodium azide; pH 7.2
Immunogen	Recombinant protein corresponding to Human Aquaporin 4. Recombinant protein control fragment (Product #RP-91109).
Classification	Polyclonal
Primary or Secondary	Primary

5,087

Invitrogen™ Phospho-DRP1 (Ser616) Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	O00429, O35303, Q8K1M6
Isotype	IgG
Concentration	1 mg/mL
Antigen	Phospho-DRP1 (Ser616)
Gene Symbols	DNM1L
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	6330417M19Rik; AI450666; C-terminal region; Dlp1; dnm1l; Dnm1p/Vps1p-like protein; Dnml1; Dnmlp1; Drp1; DVLP; DYMPLE; dynamin 1 like; dynamin 1-like; dynamin family member proline-rich carboxyl-terminal domain less; Dynamin-1-like protein; Dynamin-1-like protein-like protein; Dynamin-like protein; dynamin-like protein 1; dynamin-like protein 4; Dynamin-like protein IV; dynamin-related protein 1; DYNIV 11; DYNIV-11; EC 3.6.5.5; EGK_03514; EMPF; FLJ41912; HDYNIV; N-terminal region; python; similar to dynamin 1-like; VPS1; zgc:66163
Gene	DNM1L
Product Type	Antibody
Gene ID (Entrez)	10059, 114114, 74006
Formulation	PBS with 50% glycerol, 0.5% BSA and 0.02% sodium azide; pH 7.4
Immunogen	A synthesized peptide derived from human DRP1 (Phospho-Ser616).
Classification	Polyclonal
Primary or Secondary	Primary

5,088

Invitrogen™ Ferroportin Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	Q9NP59
Isotype	IgG
Concentration	0.40 mg/mL
Antigen	Ferroportin
Gene Symbols	SLC40A1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	CAR1; Cell adhesion regulator; duodenal-specific; Dusg; Ferroportin; ferroportin 1; ferroportin-1; Fpn1; Fpt1; HFE4; IREG1; iron regulated gene 1; iron-regulated transporter 1; Metal transporter protein 1; metal transporting protein 1; MST079; MSTP079; MTP; MTP1; Ol5; Pcm; polycythaemia; Slc11a3; SLC11A3 iron transporter; Slc39a1; Slc40a1; solute carrier family 11 (proton-coupled divalent metal ion transporters), member 3; solute carrier family 39 (iron-regulated transporter), member 1; solute carrier family 40 (iron-regulated transporter), member 1; solute carrier family 40 member 1
Gene	SLC40A1
Product Type	Antibody
Gene ID (Entrez)	30061
Formulation	PBS with 40% glycerol and 0.02% sodium azide; pH 7.2
Immunogen	Recombinant protein corresponding to Human SLC40A1. Recombinant protein control fragment (Product #RP-104220).
Classification	Polyclonal
Primary or Secondary	Primary

5,089

Invitrogen™ Aquaporin 3 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Lyophilized
Gene Accession No.	P47862, Q8R2N1, Q92482
Isotype	IgG
Concentration	500 μg/mL
Antigen	Aquaporin 3
Gene Symbols	AQP3
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	31.4 kDa water channel protein; AQP 3; AQP-2; AQP3; AQP-3; Aquaglyceroporin-3; aquaporin 3; aquaporin 3 (GIL blood group); aquaporin 3 (Gill blood group); Aquaporin3; aquaporin-3; GIL; Gill blood group
Gene	AQP3
Product Type	Antibody
Gene ID (Entrez)	11828, 360, 65133
Formulation	Antibody with 0.2mg Na2PO4, 0.9mg NaCl, 4mg trehalose and no preservative
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human Aquaporin 3 (278-292aa EENVKLAHVKHKEQI).
Classification	Polyclonal
Primary or Secondary	Primary

5,090

Invitrogen™ BIK Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Lyophilized
Gene Accession No.	O70337, Q13323
Isotype	IgG
Concentration	500 μg/mL
Antigen	BIK
Gene Symbols	BIK
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	apoptosis inducer NBK; apoptosis-inducing NBK; BBC1; BCL2 interacting killer; bcl-2-interacting killer; BCL2-interacting killer; BCL2-interacting killer (apoptosis-inducing); bhikhari; BIK; Bik-like killer protein; Biklk; BIP 1; BIP1; Blk; BP 4; BP4; cb 60; natural born killer; NBK
Gene	BIK
Product Type	Antibody
Gene ID (Entrez)	114496, 12124, 638
Formulation	PBS with 5mg BSA and 0.05mg sodium azide
Immunogen	E.coli-derived human Bik recombinant protein (Position: M1-R123).
Classification	Polyclonal
Primary or Secondary	Primary

5,091

Invitrogen™ ITGB1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat,Canine
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P05556, P09055, P49134
Isotype	IgG
Concentration	0.6 mg/mL
Antigen	ITGB1
Gene Symbols	ITGB1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	4633401G24Rik; AA409975; AA960159; Beta OL; beta oligodendroglia; CD29; CSAT antigen; ENSMUSG00000051907; Fibronectin receptor subunit beta; FNRB; Glycoprotein IIa; Gm9863; gpIIa; integrin beta 1; integrin beta 1 (fibronectin receptor beta); integrin beta 1A precursor; Integrin beta1; integrin beta-1; integrin beta-1 subunit; integrin beta1D; integrin precursor; integrin subunit beta 1; integrin VLA-4 beta subunit; integrin VLA-4 subunit beta; integrin, beta 1; integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12); ITBG1D; ITGB1; JG22 antigen; MDF2; MSK12; RGD-receptor; very late activation protein, beta polypeptide; VLA-4 subunit beta; VLAB; VLA-BETA
Gene	ITGB1
Product Type	Antibody
Gene ID (Entrez)	16412, 24511, 3688, 477956
Formulation	PBS with 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen	Synthetic peptide encompassing a sequence within the Intracellular domain of human Integrin beta 1/CD29. The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

5,092

Invitrogen™ Neurogenin 2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P70447, Q9H2A3
Isotype	IgG
Concentration	1.13 mg/mL
Antigen	Neurogenin 2
Gene Symbols	NEUROG2
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	Ath4a; ATOH4; atonal homolog 4; bHLHa8; Class A basic helix-loop-helix protein 8; helix-loop-helix protein mATH-4A; mATH4A; NEUROG2; neurogenin 2; neurogenin2; neurogenin-2; NGN2; NGN-2; Protein atonal homolog 4
Gene	NEUROG2
Product Type	Antibody
Gene ID (Entrez)	11924, 295475, 63973
Formulation	PBS with 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen	Recombinant protein encompassing a sequence within the center region of human Neurogenin 2. The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

5,093

Invitrogen™ CD68 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	P31996
Isotype	IgG
Concentration	500 μg/mL
Antigen	CD68
Gene Symbols	Cd68
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	CD68; CD68 antigen; CD68 molecule; GP110; Lamp4; macrophage antigen CD68; macrosialin; Scard1; scavenger receptor class D, member 1; similar to CD68 antigen
Gene	Cd68
Product Type	Antibody
Gene ID (Entrez)	12514, 287435
Formulation	PBS with 4mg trehalose and no preservative
Immunogen	A synthetic peptide corresponding to a sequence in the middle region of mouse CD68 (312-326aa AFCITRRRQSTYQPL).
Classification	Polyclonal
Primary or Secondary	Primary

5,094

Invitrogen™ Ninjurin 1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Immunohistochemistry (Paraffin)
Form	Liquid
Gene Accession No.	O70131, P70617, Q92982
Isotype	IgG
Concentration	1 mg/mL
Antigen	Ninjurin 1
Gene Symbols	Ninj1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	AU024536; Nerve injury-induced protein 1; nerve injury-induced protein-1; NIN1; Ninj1; NINJURIN; ninjurin 1; ninjurin-1
Gene	Ninj1
Product Type	Antibody
Gene ID (Entrez)	18081, 25338, 4814
Formulation	PBS with 0.02% sodium azide
Immunogen	NINJ1 antibody for a 15 amino acid peptide near the carboxy terminus of human NINJ1. The immunogen is within the last 50 amino acids of NINJ1.
Classification	Polyclonal
Primary or Secondary	Primary

5,095

Invitrogen™ NLRP3 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Western Blot
Form	Lyophilized
Gene Accession No.	D4A523, Q8R4B8, Q96P20
Isotype	IgG
Concentration	500 μg/mL
Antigen	NLRP3
Gene Symbols	NLRP3
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	AGTAVPRL; AII; AII/AVP; Angiotensin/vasopressin receptor AII/AVP-like; AVP; C1orf7; caterpiller protein 1.1; Cias1; CLR1.1; cold autoinflammatory syndrome 1 homolog; cold autoinflammatory syndrome 1 protein; cold autoinflammatory syndrome 1 protein homolog; Cold-induced autoinflammatory syndrome 1 protein; cryopyrin; FCAS; FCAS1; FCU; FLJ95925; mast cell maturation inducible protein 1; mast cell maturation-associated-inducible protein 1; Mmig1; MWS; NACHT domain-, leucine-rich repeat-, and PYD-containing protein 3; NACHT, LRR and PYD containing protein 3; NACHT, LRR and PYD domains-containing protein 3; NACHT/LRR/pyrin domain-containing protein 3; NALP3; NLR family pyrin domain containing 3; NLR family, pyrin domain containing 3; Nlrp3; nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domain containing 3; PYPAF1; PYRIN-containing APAF1-like protein 1
Gene	NLRP3
Product Type	Antibody
Gene ID (Entrez)	114548, 216799, 287362
Formulation	PBS with 4mg trehalose and no preservative
Immunogen	A synthetic peptide corresponding to a sequence at the N-terminus of human CIAS1 (12-31aa RYLEDLEDVDLKKFKMHLED).
Classification	Polyclonal
Primary or Secondary	Primary

5,096

Invitrogen™ CYP27B1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	O15528, O35084, O35132
Isotype	IgG
Concentration	500 μg/mL
Antigen	CYP27B1
Gene Symbols	CYP27B1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	1alpha(OH)ase; 25 hydroxyvitamin D3-1-alpha hydroxylase; 25(OH)D 1alpha-hydroxylase; 25-hydroxyvitamin D(3) 1-alpha-hydroxylase; 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial; 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial precursor (25-OHD-1 alpha-hydroxylase) (25-hydroxyvitamin D3 1-alpha-hydroxylase) (VD3 1A hydroxylase) (P450C1 alpha) (P450VD1-alpha); 25-hydroxyvitamin D3 1alpha-hydroxylase; 25-OHD-1 alpha-hydroxylase; Calcidiol 1-monooxygenase; Cp2b; cy; Cyp1; CYP1alpha; Cyp27b; Cyp27b1; Cyp40; cytochrome p450 27B1; cytochrome P450 40 (25-hydroxyvitamin D3 1 alpha-hydroxylase); cytochrome P450 family 27 subfamily B member 1; cytochrome P450 subfamily XXVIIB (25-hydroxyvitamin D-1-alpha-hydroxylase) polypeptide 1; cytochrome P450 subfamily XXVIIB polypeptide 1; cytochrome P450, 27b1; cytochrome P450, 40 (25-hydroxyvitamin D3 1 alpha-hydroxylase); cytochrome P450, family 27, subfamily B, polypeptide 1; cytochrome P450, subfamily 27b, polypeptide 1; cytochrome P450C1 alpha; Cytochrome P450VD1-alpha; P450c1; P450C1 alpha; P450VD1alpha; P450VD1-alpha; Pddr; VD3 1A hydroxylase; Vdd1; Vddr; VDDRI; VDR
Gene	CYP27B1
Product Type	Antibody
Gene ID (Entrez)	114700, 13115, 1594
Formulation	PBS with 5mg BSA and 0.05mg sodium azide
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human CYP27B1 (475-508aa HFEVQPEPGAAPVRPKTRTVLVPERSINLQFLDR).
Classification	Polyclonal
Primary or Secondary	Primary

5,097

Invitrogen™ PLZF Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot
Form	Liquid
Gene Accession No.	Q05516
Isotype	IgG
Concentration	0.2 mg/mL
Antigen	PLZF
Gene Symbols	ZBTB16
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	AI467657; Green's luxoid; lu; luxoid; Lx; PLZF; Polydactyly-luxate syndrome; promyelocytic leukaemia zinc finger; promyelocytic leukemia zinc finger; Promyelocytic leukemia zinc finger protein; ZBTB16; Zfp145; zinc finger and BTB domain containing 16; zinc finger and BTB domain containing 16 protein; zinc finger and BTB domain-containing protein 16; Zinc finger protein 145; zinc finger protein 145 (Kruppel-like, expressed in promyelocytic leukemia); zinc finger protein PLZF; ZNF145
Gene	ZBTB16
Product Type	Antibody
Gene ID (Entrez)	7704
Formulation	PBS with 40% glycerol and 0.02% sodium azide; pH 7.2
Immunogen	Recombinant protein corresponding to Human ZBTB16. Recombinant protein control fragment (Product #RP-100699).
Classification	Polyclonal
Primary or Secondary	Primary

5,098

Invitrogen™ CD41 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	P08514, Q9QUM0
Isotype	IgG
Concentration	500 μg/mL
Antigen	CD41
Gene Symbols	Itga2b
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	AI172977; alpha IIb; alphaIIb; alphaIIb protein; BDPLT16; BDPLT2; CD41; CD41B; form 1; form 2; GP IIb; GP2B; GPalpha IIb; GPIIb; GT; GTA; HPA3; integrin alpha 2b; integrin alpha 2b (Cd41b); integrin alpha-IIb; Integrin alpha-IIb heavy chain; Integrin alpha-IIb light chain; Integrin alpha-IIb light chain, form 1; Integrin alpha-IIb light chain, form 2; integrin subunit alpha 2b; integrin subunit alpha IIb; integrin, alpha 2B; integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41); ITGA2B; ITGAB; platelet fibrinogen receptor, alpha subunit; platelet glycoprotein IIb; platelet glycoprotein IIb of IIb/II Ia complex; platelet glycoprotein IIb of IIb/IIIa complex; platelet membrane glycoprotein IIb; platelet-specific antigen BAK; PPP1R93; protein phosphatase 1, regulatory subunit 93
Gene	Itga2b
Product Type	Antibody
Gene ID (Entrez)	16399, 3674, 685269
Formulation	PBS with 5mg BSA and 0.05mg sodium azide
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human ITGA2B (677-711aa EAELAVHLPQGAHYMRALSNVEGFERLICNQKKEN).
Classification	Polyclonal
Primary or Secondary	Primary

5,099

Invitrogen™ VWF Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry,Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	Q62935, Q8CIZ8
Isotype	IgG
Concentration	500 μg/mL
Antigen	VWF
Gene Symbols	VWF
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	6820430P06Rik; AI551257; B130011O06Rik; C630030D09; Coagulation Factor VIII; coagulation factor VIII VWF; EMBL:CAB37852.1}; F8VWF; factor viii related antigen; von Willebrand antigen 2; von Willebrand antigen II; von Willebrand Disease (vWD); von Willebrand factor; Von Willebrand factor homolog; VWD; vwf; vwf {ECO:0000312
Gene	VWF
Product Type	Antibody
Gene ID (Entrez)	116669, 22371
Formulation	PBS with 5mg BSA and 0.05mg sodium azide
Immunogen	E.coli-derived mouse VWF recombinant protein (Position: M1304-E1452).
Classification	Polyclonal
Primary or Secondary	Primary

5,100

Invitrogen™ CD11b Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	P05555, P11215
Isotype	IgG
Concentration	500 μg/mL
Antigen	CD11b
Gene Symbols	ITGAM
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	antigen CD11b (p170); antigen CD11b (p170); macrophage antigen alpha polypeptide; CD11 antigen-like family member B; CD11b; CD11B (p170); CD11b/CD18; cell surface glycoprotein MAC-1 alpha subunit; cell surface glycoprotein MAC-1 subunit alpha; complement component 3 receptor 3 subunit; complement component receptor 3 alpha-a; complement receptor type 3; CR3; CR-3 alpha chain; CR3A; F730045J24Rik; integrin alpha M; integrin alpha-M; integrin subunit alpha M; integrin, alpha M; integrin, alpha M (complement component 3 receptor 3 subunit); ITGAM; Leukocyte adhesion receptor MO1; leukocyte integrin alpha-M chain; LOC100351865; Ly-40; MAC1; Mac-1; Mac-1 alpha; Mac-1 alpha (Mac1A); MAC-1 alpha subunit; MAC1A; Mac-1a; macrophage antigen alpha; macrophage antigen alpha polypeptide; MGC117044; MO1A; Neutrophil adherence receptor; neutrophil adherence receptor alpha-M subunit; SLEB6; unnamed protein product
Gene	ITGAM
Product Type	Antibody
Gene ID (Entrez)	16409, 25021, 3684
Formulation	PBS with 4mg trehalose and no preservative
Immunogen	E.coli-derived human CD11b recombinant protein (Position: F17-T382).
Classification	Polyclonal
Primary or Secondary	Primary

Primary Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ Aquaporin 4 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Phospho-DRP1 (Ser616) Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Ferroportin Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Aquaporin 3 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ BIK Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ ITGB1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Neurogenin 2 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD68 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Ninjurin 1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ NLRP3 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CYP27B1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ PLZF Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD41 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ VWF Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD11b Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Aquaporin 4 Polyclonal Antibody

Invitrogen™ Phospho-DRP1 (Ser616) Polyclonal Antibody

Invitrogen™ Ferroportin Polyclonal Antibody

Invitrogen™ Aquaporin 3 Polyclonal Antibody

Invitrogen™ BIK Polyclonal Antibody

Invitrogen™ ITGB1 Polyclonal Antibody

Invitrogen™ Neurogenin 2 Polyclonal Antibody

Invitrogen™ CD68 Polyclonal Antibody

Invitrogen™ Ninjurin 1 Polyclonal Antibody

Invitrogen™ NLRP3 Polyclonal Antibody

Invitrogen™ CYP27B1 Polyclonal Antibody

Invitrogen™ PLZF Polyclonal Antibody

Invitrogen™ CD41 Polyclonal Antibody

Invitrogen™ VWF Polyclonal Antibody

Invitrogen™ CD11b Polyclonal Antibody